Anti MRPL27 pAb (ATL-HPA021416)

Atlas Antibodies

Catalog No.:
ATL-HPA021416-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: mitochondrial ribosomal protein L27
Gene Name: MRPL27
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024414: 89%, ENSRNOG00000003724: 89%
Entrez Gene ID: 51264
Uniprot ID: Q9P0M9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HPGAHVGVGKNKCLYALEEGIVRYTKEVYVPHPRNTEAVDLITRLPKGAVLYKTFVHVVPAKPEGTFKLVAML
Gene Sequence HPGAHVGVGKNKCLYALEEGIVRYTKEVYVPHPRNTEAVDLITRLPKGAVLYKTFVHVVPAKPEGTFKLVAML
Gene ID - Mouse ENSMUSG00000024414
Gene ID - Rat ENSRNOG00000003724
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MRPL27 pAb (ATL-HPA021416)
Datasheet Anti MRPL27 pAb (ATL-HPA021416) Datasheet (External Link)
Vendor Page Anti MRPL27 pAb (ATL-HPA021416) at Atlas Antibodies

Documents & Links for Anti MRPL27 pAb (ATL-HPA021416)
Datasheet Anti MRPL27 pAb (ATL-HPA021416) Datasheet (External Link)
Vendor Page Anti MRPL27 pAb (ATL-HPA021416)