Anti MRPL14 pAb (ATL-HPA076790)
Atlas Antibodies
- Catalog No.:
- ATL-HPA076790-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: MRPL14
Alternative Gene Name: MRP-L32, RPML32
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023939: 86%, ENSRNOG00000019734: 89%
Entrez Gene ID: 64928
Uniprot ID: Q6P1L8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FSTTGSLSAIQKMTRVRVVDNSALGNSPYHRAPRCIHVYKKNGVGKVGDQILLAIK |
| Gene Sequence | FSTTGSLSAIQKMTRVRVVDNSALGNSPYHRAPRCIHVYKKNGVGKVGDQILLAIK |
| Gene ID - Mouse | ENSMUSG00000023939 |
| Gene ID - Rat | ENSRNOG00000019734 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MRPL14 pAb (ATL-HPA076790) | |
| Datasheet | Anti MRPL14 pAb (ATL-HPA076790) Datasheet (External Link) |
| Vendor Page | Anti MRPL14 pAb (ATL-HPA076790) at Atlas Antibodies |
| Documents & Links for Anti MRPL14 pAb (ATL-HPA076790) | |
| Datasheet | Anti MRPL14 pAb (ATL-HPA076790) Datasheet (External Link) |
| Vendor Page | Anti MRPL14 pAb (ATL-HPA076790) |