Anti MRPL14 pAb (ATL-HPA076790)

Atlas Antibodies

Catalog No.:
ATL-HPA076790-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: mitochondrial ribosomal protein L14
Gene Name: MRPL14
Alternative Gene Name: MRP-L32, RPML32
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023939: 86%, ENSRNOG00000019734: 89%
Entrez Gene ID: 64928
Uniprot ID: Q6P1L8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FSTTGSLSAIQKMTRVRVVDNSALGNSPYHRAPRCIHVYKKNGVGKVGDQILLAIK
Gene Sequence FSTTGSLSAIQKMTRVRVVDNSALGNSPYHRAPRCIHVYKKNGVGKVGDQILLAIK
Gene ID - Mouse ENSMUSG00000023939
Gene ID - Rat ENSRNOG00000019734
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MRPL14 pAb (ATL-HPA076790)
Datasheet Anti MRPL14 pAb (ATL-HPA076790) Datasheet (External Link)
Vendor Page Anti MRPL14 pAb (ATL-HPA076790) at Atlas Antibodies

Documents & Links for Anti MRPL14 pAb (ATL-HPA076790)
Datasheet Anti MRPL14 pAb (ATL-HPA076790) Datasheet (External Link)
Vendor Page Anti MRPL14 pAb (ATL-HPA076790)