Anti MRPL11 pAb (ATL-HPA057685)

Atlas Antibodies

Catalog No.:
ATL-HPA057685-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: mitochondrial ribosomal protein L11
Gene Name: MRPL11
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024902: 90%, ENSRNOG00000019970: 91%
Entrez Gene ID: 65003
Uniprot ID: Q9Y3B7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PTVSYFLKAAAGIEKGARQTGKEVAGLVTLKHVYEIARIKAQDEAFALQDVPLSSVVRSIIGSARSLGIR
Gene Sequence PTVSYFLKAAAGIEKGARQTGKEVAGLVTLKHVYEIARIKAQDEAFALQDVPLSSVVRSIIGSARSLGIR
Gene ID - Mouse ENSMUSG00000024902
Gene ID - Rat ENSRNOG00000019970
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MRPL11 pAb (ATL-HPA057685)
Datasheet Anti MRPL11 pAb (ATL-HPA057685) Datasheet (External Link)
Vendor Page Anti MRPL11 pAb (ATL-HPA057685) at Atlas Antibodies

Documents & Links for Anti MRPL11 pAb (ATL-HPA057685)
Datasheet Anti MRPL11 pAb (ATL-HPA057685) Datasheet (External Link)
Vendor Page Anti MRPL11 pAb (ATL-HPA057685)