Anti MRM2 pAb (ATL-HPA019826)

Atlas Antibodies

Catalog No.: ATL-HPA019826-25

Protein Description: mitochondrial rRNA methyltransferase 2
Gene Name: MRM2
Alternative Gene Name: FJH1, FTSJ2, RRMJ2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029557: 89%, ENSRNOG00000043267: 89%
Entrez Gene ID: 29960
Uniprot ID: Q9UI43
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DPSSPVGFVLGVDLLHIFPLEGATFLCPADVTDPRTSQRILEVLPGRRADVILSDMAPNATGFRDLDHDRLI
• Gene Sequence: DPSSPVGFVLGVDLLHIFPLEGATFLCPADVTDPRTSQRILEVLPGRRADVILSDMAPNATGFRDLDHDRLI
• Gene ID - Mouse: ENSMUSG00000029557
• Gene ID - Rat: ENSRNOG00000043267
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.