Anti MRM1 pAb (ATL-HPA021598)

Atlas Antibodies

Catalog No.: ATL-HPA021598-25

Protein Description: mitochondrial rRNA methyltransferase 1 homolog (S. cerevisiae)
Gene Name: MRM1
Alternative Gene Name: FLJ22578
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018405: 62%, ENSRNOG00000027901: 58%
Entrez Gene ID: 79922
Uniprot ID: Q6IN84
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SCQLLLTILPRRQLPPGLESLNVSVAAGILLHSICSQRKGFPTEGERRQLLQDPQEPSARSEGLSMAQHPGLSS
• Gene Sequence: SCQLLLTILPRRQLPPGLESLNVSVAAGILLHSICSQRKGFPTEGERRQLLQDPQEPSARSEGLSMAQHPGLSS
• Gene ID - Mouse: ENSMUSG00000018405
• Gene ID - Rat: ENSRNOG00000027901
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.