Anti MRGPRX2 pAb (ATL-HPA055220)

Atlas Antibodies

Catalog No.:
ATL-HPA055220-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: MAS-related GPR, member X2
Gene Name: MRGPRX2
Alternative Gene Name: MRGX2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058301: 37%, ENSRNOG00000014266: 43%
Entrez Gene ID: 117194
Uniprot ID: Q96LB1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ALQRALQDIAEVDHSEGCFRQGTPEMSRSS
Gene Sequence ALQRALQDIAEVDHSEGCFRQGTPEMSRSS
Gene ID - Mouse ENSMUSG00000058301
Gene ID - Rat ENSRNOG00000014266
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MRGPRX2 pAb (ATL-HPA055220)
Datasheet Anti MRGPRX2 pAb (ATL-HPA055220) Datasheet (External Link)
Vendor Page Anti MRGPRX2 pAb (ATL-HPA055220) at Atlas Antibodies

Documents & Links for Anti MRGPRX2 pAb (ATL-HPA055220)
Datasheet Anti MRGPRX2 pAb (ATL-HPA055220) Datasheet (External Link)
Vendor Page Anti MRGPRX2 pAb (ATL-HPA055220)