Anti MRAP pAb (ATL-HPA011024)

Atlas Antibodies

Catalog No.: ATL-HPA011024-25

Protein Description: melanocortin 2 receptor accessory protein
Gene Name: MRAP
Alternative Gene Name: B27, C21orf61, FALP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039956: 84%, ENSRNOG00000021524: 81%
Entrez Gene ID: 56246
Uniprot ID: Q8TCY5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MANGTNASAPYYSYEYYLDYLDLIPVDEKKLKAHKHS
• Gene Sequence: MANGTNASAPYYSYEYYLDYLDLIPVDEKKLKAHKHS
• Gene ID - Mouse: ENSMUSG00000039956
• Gene ID - Rat: ENSRNOG00000021524
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.