Anti MR1 pAb (ATL-HPA048304)

Atlas Antibodies

Catalog No.:
ATL-HPA048304-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: major histocompatibility complex, class I-related
Gene Name: MR1
Alternative Gene Name: HLALS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026471: 79%, ENSRNOG00000003522: 79%
Entrez Gene ID: 3140
Uniprot ID: Q95460
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LSWLAVDNVAHTIKQAWEANQHELLYQKNWLEEECIAWLKRFLEYGKDTLQRTEPPLVRVNRKETFPGVTALFCKAHG
Gene Sequence LSWLAVDNVAHTIKQAWEANQHELLYQKNWLEEECIAWLKRFLEYGKDTLQRTEPPLVRVNRKETFPGVTALFCKAHG
Gene ID - Mouse ENSMUSG00000026471
Gene ID - Rat ENSRNOG00000003522
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MR1 pAb (ATL-HPA048304)
Datasheet Anti MR1 pAb (ATL-HPA048304) Datasheet (External Link)
Vendor Page Anti MR1 pAb (ATL-HPA048304) at Atlas Antibodies

Documents & Links for Anti MR1 pAb (ATL-HPA048304)
Datasheet Anti MR1 pAb (ATL-HPA048304) Datasheet (External Link)
Vendor Page Anti MR1 pAb (ATL-HPA048304)