Anti MR1 pAb (ATL-HPA048304)

Atlas Antibodies

Catalog No.: ATL-HPA048304-25

Protein Description: major histocompatibility complex, class I-related
Gene Name: MR1
Alternative Gene Name: HLALS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026471: 79%, ENSRNOG00000003522: 79%
Entrez Gene ID: 3140
Uniprot ID: Q95460
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LSWLAVDNVAHTIKQAWEANQHELLYQKNWLEEECIAWLKRFLEYGKDTLQRTEPPLVRVNRKETFPGVTALFCKAHG
• Gene Sequence: LSWLAVDNVAHTIKQAWEANQHELLYQKNWLEEECIAWLKRFLEYGKDTLQRTEPPLVRVNRKETFPGVTALFCKAHG
• Gene ID - Mouse: ENSMUSG00000026471
• Gene ID - Rat: ENSRNOG00000003522
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.