Anti MPZL2 pAb (ATL-HPA060740)

Atlas Antibodies

Catalog No.:
ATL-HPA060740-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: myelin protein zero-like 2
Gene Name: MPZL2
Alternative Gene Name: EVA, EVA1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032092: 71%, ENSRNOG00000016085: 77%
Entrez Gene ID: 10205
Uniprot ID: O60487
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VLFQHYRKKRWAERAHKVVEIKSKEEERLNQ
Gene Sequence VLFQHYRKKRWAERAHKVVEIKSKEEERLNQ
Gene ID - Mouse ENSMUSG00000032092
Gene ID - Rat ENSRNOG00000016085
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MPZL2 pAb (ATL-HPA060740)
Datasheet Anti MPZL2 pAb (ATL-HPA060740) Datasheet (External Link)
Vendor Page Anti MPZL2 pAb (ATL-HPA060740) at Atlas Antibodies

Documents & Links for Anti MPZL2 pAb (ATL-HPA060740)
Datasheet Anti MPZL2 pAb (ATL-HPA060740) Datasheet (External Link)
Vendor Page Anti MPZL2 pAb (ATL-HPA060740)