Anti MPZL2 pAb (ATL-HPA060740)
Atlas Antibodies
- Catalog No.:
- ATL-HPA060740-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: MPZL2
Alternative Gene Name: EVA, EVA1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032092: 71%, ENSRNOG00000016085: 77%
Entrez Gene ID: 10205
Uniprot ID: O60487
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VLFQHYRKKRWAERAHKVVEIKSKEEERLNQ |
| Gene Sequence | VLFQHYRKKRWAERAHKVVEIKSKEEERLNQ |
| Gene ID - Mouse | ENSMUSG00000032092 |
| Gene ID - Rat | ENSRNOG00000016085 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MPZL2 pAb (ATL-HPA060740) | |
| Datasheet | Anti MPZL2 pAb (ATL-HPA060740) Datasheet (External Link) |
| Vendor Page | Anti MPZL2 pAb (ATL-HPA060740) at Atlas Antibodies |
| Documents & Links for Anti MPZL2 pAb (ATL-HPA060740) | |
| Datasheet | Anti MPZL2 pAb (ATL-HPA060740) Datasheet (External Link) |
| Vendor Page | Anti MPZL2 pAb (ATL-HPA060740) |