Anti MPZL2 pAb (ATL-HPA060740)

Atlas Antibodies

SKU: ATL-HPA060740-25

• 
• 

Protein Description: myelin protein zero-like 2
Gene Name: MPZL2
Alternative Gene Name: EVA, EVA1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032092: 71%, ENSRNOG00000016085: 77%
Entrez Gene ID: 10205
Uniprot ID: O60487
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VLFQHYRKKRWAERAHKVVEIKSKEEERLNQ
• Gene Sequence: VLFQHYRKKRWAERAHKVVEIKSKEEERLNQ
• Gene ID - Mouse: ENSMUSG00000032092
• Gene ID - Rat: ENSRNOG00000016085
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.