Anti MPZL1 pAb (ATL-HPA063538)

Atlas Antibodies

Catalog No.:
ATL-HPA063538-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: myelin protein zero-like 1
Gene Name: MPZL1
Alternative Gene Name: FLJ21047, PZR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026566: 91%, ENSRNOG00000003248: 91%
Entrez Gene ID: 9019
Uniprot ID: O95297
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NSKRDYTGCSTSESLSPVKQAPRKSPSDTEGLVKSLPSGSHQGPVIYAQLDHSGGHHSDKINKSESVVYADIRKN
Gene Sequence NSKRDYTGCSTSESLSPVKQAPRKSPSDTEGLVKSLPSGSHQGPVIYAQLDHSGGHHSDKINKSESVVYADIRKN
Gene ID - Mouse ENSMUSG00000026566
Gene ID - Rat ENSRNOG00000003248
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MPZL1 pAb (ATL-HPA063538)
Datasheet Anti MPZL1 pAb (ATL-HPA063538) Datasheet (External Link)
Vendor Page Anti MPZL1 pAb (ATL-HPA063538) at Atlas Antibodies

Documents & Links for Anti MPZL1 pAb (ATL-HPA063538)
Datasheet Anti MPZL1 pAb (ATL-HPA063538) Datasheet (External Link)
Vendor Page Anti MPZL1 pAb (ATL-HPA063538)