Anti MPZ pAb (ATL-HPA068925)
Atlas Antibodies
- Catalog No.:
- ATL-HPA068925-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: MPZ
Alternative Gene Name: CMT1, CMT1B, CMT2I, CMT2J, HMSNIB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056569: 87%, ENSRNOG00000003171: 89%
Entrez Gene ID: 4359
Uniprot ID: P25189
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AMEKGKLHKPGKDASKRGRQTPVLYAMLDHSRSTKAVSEKKAKGLGESRKDKK |
| Gene Sequence | AMEKGKLHKPGKDASKRGRQTPVLYAMLDHSRSTKAVSEKKAKGLGESRKDKK |
| Gene ID - Mouse | ENSMUSG00000056569 |
| Gene ID - Rat | ENSRNOG00000003171 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MPZ pAb (ATL-HPA068925) | |
| Datasheet | Anti MPZ pAb (ATL-HPA068925) Datasheet (External Link) |
| Vendor Page | Anti MPZ pAb (ATL-HPA068925) at Atlas Antibodies |
| Documents & Links for Anti MPZ pAb (ATL-HPA068925) | |
| Datasheet | Anti MPZ pAb (ATL-HPA068925) Datasheet (External Link) |
| Vendor Page | Anti MPZ pAb (ATL-HPA068925) |