Anti MPZ pAb (ATL-HPA068925)

Atlas Antibodies

Catalog No.:
ATL-HPA068925-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: myelin protein zero
Gene Name: MPZ
Alternative Gene Name: CMT1, CMT1B, CMT2I, CMT2J, HMSNIB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056569: 87%, ENSRNOG00000003171: 89%
Entrez Gene ID: 4359
Uniprot ID: P25189
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AMEKGKLHKPGKDASKRGRQTPVLYAMLDHSRSTKAVSEKKAKGLGESRKDKK
Gene Sequence AMEKGKLHKPGKDASKRGRQTPVLYAMLDHSRSTKAVSEKKAKGLGESRKDKK
Gene ID - Mouse ENSMUSG00000056569
Gene ID - Rat ENSRNOG00000003171
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MPZ pAb (ATL-HPA068925)
Datasheet Anti MPZ pAb (ATL-HPA068925) Datasheet (External Link)
Vendor Page Anti MPZ pAb (ATL-HPA068925) at Atlas Antibodies

Documents & Links for Anti MPZ pAb (ATL-HPA068925)
Datasheet Anti MPZ pAb (ATL-HPA068925) Datasheet (External Link)
Vendor Page Anti MPZ pAb (ATL-HPA068925)