Anti MPZ pAb (ATL-HPA068925)

Atlas Antibodies

SKU: ATL-HPA068925-25

• 

Protein Description: myelin protein zero
Gene Name: MPZ
Alternative Gene Name: CMT1, CMT1B, CMT2I, CMT2J, HMSNIB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056569: 87%, ENSRNOG00000003171: 89%
Entrez Gene ID: 4359
Uniprot ID: P25189
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AMEKGKLHKPGKDASKRGRQTPVLYAMLDHSRSTKAVSEKKAKGLGESRKDKK
• Gene Sequence: AMEKGKLHKPGKDASKRGRQTPVLYAMLDHSRSTKAVSEKKAKGLGESRKDKK
• Gene ID - Mouse: ENSMUSG00000056569
• Gene ID - Rat: ENSRNOG00000003171
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.