Anti MPP7 pAb (ATL-HPA037597)
Atlas Antibodies
- Catalog No.:
- ATL-HPA037597-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: MPP7
Alternative Gene Name: FLJ32798
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057440: 91%, ENSRNOG00000018760: 95%
Entrez Gene ID: 143098
Uniprot ID: Q5T2T1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QERRLALRRPEILVQPLKVSNRKSSGFRRSFRLSRKDKKTNKSMYECKKSDQYDTADVPTYEEVT |
| Gene Sequence | QERRLALRRPEILVQPLKVSNRKSSGFRRSFRLSRKDKKTNKSMYECKKSDQYDTADVPTYEEVT |
| Gene ID - Mouse | ENSMUSG00000057440 |
| Gene ID - Rat | ENSRNOG00000018760 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MPP7 pAb (ATL-HPA037597) | |
| Datasheet | Anti MPP7 pAb (ATL-HPA037597) Datasheet (External Link) |
| Vendor Page | Anti MPP7 pAb (ATL-HPA037597) at Atlas Antibodies |
| Documents & Links for Anti MPP7 pAb (ATL-HPA037597) | |
| Datasheet | Anti MPP7 pAb (ATL-HPA037597) Datasheet (External Link) |
| Vendor Page | Anti MPP7 pAb (ATL-HPA037597) |