Anti MPP7 pAb (ATL-HPA037597)

Atlas Antibodies

Catalog No.: ATL-HPA037597-25

Protein Description: membrane protein, palmitoylated 7 (MAGUK p55 subfamily member 7)
Gene Name: MPP7
Alternative Gene Name: FLJ32798
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057440: 91%, ENSRNOG00000018760: 95%
Entrez Gene ID: 143098
Uniprot ID: Q5T2T1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QERRLALRRPEILVQPLKVSNRKSSGFRRSFRLSRKDKKTNKSMYECKKSDQYDTADVPTYEEVT
• Gene Sequence: QERRLALRRPEILVQPLKVSNRKSSGFRRSFRLSRKDKKTNKSMYECKKSDQYDTADVPTYEEVT
• Gene ID - Mouse: ENSMUSG00000057440
• Gene ID - Rat: ENSRNOG00000018760
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.