Anti MPP6 pAb (ATL-HPA020456 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA020456-25

Protein Description: membrane protein, palmitoylated 6 (MAGUK p55 subfamily member 6)
Gene Name: MPP6
Alternative Gene Name: p55T, PALS2, VAM-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038388: 98%, ENSRNOG00000021579: 98%
Entrez Gene ID: 51678
Uniprot ID: Q9NZW5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AAPELETLRAMHKAVVDAGITTKLLTDSDLKKTVDESARIQRAYNHYFDLIIINDN
• Gene Sequence: AAPELETLRAMHKAVVDAGITTKLLTDSDLKKTVDESARIQRAYNHYFDLIIINDN
• Gene ID - Mouse: ENSMUSG00000038388
• Gene ID - Rat: ENSRNOG00000021579
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.