Anti MPP4 pAb (ATL-HPA057393)

Atlas Antibodies

Catalog No.:
ATL-HPA057393-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: membrane palmitoylated protein 4
Gene Name: MPP4
Alternative Gene Name: DLG6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079550: 77%, ENSRNOG00000010486: 79%
Entrez Gene ID: 58538
Uniprot ID: Q96JB8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QALLKIYDCLQEFKEKKLVPATPHAQVLSYEVVELLRETPTSPEIQELRQMLQAPHFKALLSAHDTIAQKD
Gene Sequence QALLKIYDCLQEFKEKKLVPATPHAQVLSYEVVELLRETPTSPEIQELRQMLQAPHFKALLSAHDTIAQKD
Gene ID - Mouse ENSMUSG00000079550
Gene ID - Rat ENSRNOG00000010486
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MPP4 pAb (ATL-HPA057393)
Datasheet Anti MPP4 pAb (ATL-HPA057393) Datasheet (External Link)
Vendor Page Anti MPP4 pAb (ATL-HPA057393) at Atlas Antibodies

Documents & Links for Anti MPP4 pAb (ATL-HPA057393)
Datasheet Anti MPP4 pAb (ATL-HPA057393) Datasheet (External Link)
Vendor Page Anti MPP4 pAb (ATL-HPA057393)