Anti MPP4 pAb (ATL-HPA057393)
Atlas Antibodies
- Catalog No.:
- ATL-HPA057393-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: MPP4
Alternative Gene Name: DLG6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079550: 77%, ENSRNOG00000010486: 79%
Entrez Gene ID: 58538
Uniprot ID: Q96JB8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QALLKIYDCLQEFKEKKLVPATPHAQVLSYEVVELLRETPTSPEIQELRQMLQAPHFKALLSAHDTIAQKD |
Gene Sequence | QALLKIYDCLQEFKEKKLVPATPHAQVLSYEVVELLRETPTSPEIQELRQMLQAPHFKALLSAHDTIAQKD |
Gene ID - Mouse | ENSMUSG00000079550 |
Gene ID - Rat | ENSRNOG00000010486 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti MPP4 pAb (ATL-HPA057393) | |
Datasheet | Anti MPP4 pAb (ATL-HPA057393) Datasheet (External Link) |
Vendor Page | Anti MPP4 pAb (ATL-HPA057393) at Atlas Antibodies |
Documents & Links for Anti MPP4 pAb (ATL-HPA057393) | |
Datasheet | Anti MPP4 pAb (ATL-HPA057393) Datasheet (External Link) |
Vendor Page | Anti MPP4 pAb (ATL-HPA057393) |