Anti MPND pAb (ATL-HPA045475)

Atlas Antibodies

Catalog No.:
ATL-HPA045475-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: MPN domain containing
Gene Name: MPND
Alternative Gene Name: FLJ14981
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003199: 88%, ENSRNOG00000048282: 86%
Entrez Gene ID: 84954
Uniprot ID: Q8N594
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FHSHLTRSEVVGYLGGRWDVNSQMLTVLRAFPCRSRLGDAETAAAIEEEIYQSLFLRGLSLVGW
Gene Sequence FHSHLTRSEVVGYLGGRWDVNSQMLTVLRAFPCRSRLGDAETAAAIEEEIYQSLFLRGLSLVGW
Gene ID - Mouse ENSMUSG00000003199
Gene ID - Rat ENSRNOG00000048282
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MPND pAb (ATL-HPA045475)
Datasheet Anti MPND pAb (ATL-HPA045475) Datasheet (External Link)
Vendor Page Anti MPND pAb (ATL-HPA045475) at Atlas Antibodies

Documents & Links for Anti MPND pAb (ATL-HPA045475)
Datasheet Anti MPND pAb (ATL-HPA045475) Datasheet (External Link)
Vendor Page Anti MPND pAb (ATL-HPA045475)