Anti MPND pAb (ATL-HPA045475)
Atlas Antibodies
- Catalog No.:
- ATL-HPA045475-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: MPND
Alternative Gene Name: FLJ14981
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003199: 88%, ENSRNOG00000048282: 86%
Entrez Gene ID: 84954
Uniprot ID: Q8N594
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FHSHLTRSEVVGYLGGRWDVNSQMLTVLRAFPCRSRLGDAETAAAIEEEIYQSLFLRGLSLVGW |
| Gene Sequence | FHSHLTRSEVVGYLGGRWDVNSQMLTVLRAFPCRSRLGDAETAAAIEEEIYQSLFLRGLSLVGW |
| Gene ID - Mouse | ENSMUSG00000003199 |
| Gene ID - Rat | ENSRNOG00000048282 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MPND pAb (ATL-HPA045475) | |
| Datasheet | Anti MPND pAb (ATL-HPA045475) Datasheet (External Link) |
| Vendor Page | Anti MPND pAb (ATL-HPA045475) at Atlas Antibodies |
| Documents & Links for Anti MPND pAb (ATL-HPA045475) | |
| Datasheet | Anti MPND pAb (ATL-HPA045475) Datasheet (External Link) |
| Vendor Page | Anti MPND pAb (ATL-HPA045475) |