Anti MPLKIP pAb (ATL-HPA065463)
Atlas Antibodies
- Catalog No.:
- ATL-HPA065463-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: MPLKIP
Alternative Gene Name: C7orf11, ORF20, TTDN1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000012429: 94%, ENSRNOG00000013806: 94%
Entrez Gene ID: 136647
Uniprot ID: Q8TAP9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FGSPSPGGYPGSYSRSPAGSQQQFGYSPGQQQTHPQGSPRTSTPFGSGRVR |
| Gene Sequence | FGSPSPGGYPGSYSRSPAGSQQQFGYSPGQQQTHPQGSPRTSTPFGSGRVR |
| Gene ID - Mouse | ENSMUSG00000012429 |
| Gene ID - Rat | ENSRNOG00000013806 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MPLKIP pAb (ATL-HPA065463) | |
| Datasheet | Anti MPLKIP pAb (ATL-HPA065463) Datasheet (External Link) |
| Vendor Page | Anti MPLKIP pAb (ATL-HPA065463) at Atlas Antibodies |
| Documents & Links for Anti MPLKIP pAb (ATL-HPA065463) | |
| Datasheet | Anti MPLKIP pAb (ATL-HPA065463) Datasheet (External Link) |
| Vendor Page | Anti MPLKIP pAb (ATL-HPA065463) |