Anti MPIG6B pAb (ATL-HPA073017)

Atlas Antibodies

Catalog No.: ATL-HPA073017-25

Protein Description: megakaryocyte and platelet inhibitory receptor G6b
Gene Name: MPIG6B
Alternative Gene Name: C6orf25, G6b, G6b-B, NG31
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073414: 82%, ENSRNOG00000026936: 85%
Entrez Gene ID: 80739
Uniprot ID: O95866
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DRVNLSCGGVSHPIRWVWAPSFPACKGLSKGRRPILWASSSGTPTVPPLQPFVGR
• Gene Sequence: DRVNLSCGGVSHPIRWVWAPSFPACKGLSKGRRPILWASSSGTPTVPPLQPFVGR
• Gene ID - Mouse: ENSMUSG00000073414
• Gene ID - Rat: ENSRNOG00000026936
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.