Anti MPIG6B pAb (ATL-HPA073017)

Atlas Antibodies

Catalog No.:
ATL-HPA073017-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: megakaryocyte and platelet inhibitory receptor G6b
Gene Name: MPIG6B
Alternative Gene Name: C6orf25, G6b, G6b-B, NG31
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073414: 82%, ENSRNOG00000026936: 85%
Entrez Gene ID: 80739
Uniprot ID: O95866
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DRVNLSCGGVSHPIRWVWAPSFPACKGLSKGRRPILWASSSGTPTVPPLQPFVGR
Gene Sequence DRVNLSCGGVSHPIRWVWAPSFPACKGLSKGRRPILWASSSGTPTVPPLQPFVGR
Gene ID - Mouse ENSMUSG00000073414
Gene ID - Rat ENSRNOG00000026936
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MPIG6B pAb (ATL-HPA073017)
Datasheet Anti MPIG6B pAb (ATL-HPA073017) Datasheet (External Link)
Vendor Page Anti MPIG6B pAb (ATL-HPA073017) at Atlas Antibodies

Documents & Links for Anti MPIG6B pAb (ATL-HPA073017)
Datasheet Anti MPIG6B pAb (ATL-HPA073017) Datasheet (External Link)
Vendor Page Anti MPIG6B pAb (ATL-HPA073017)