Anti MPIG6B pAb (ATL-HPA054404)
Atlas Antibodies
- Catalog No.:
- ATL-HPA054404-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: MPIG6B
Alternative Gene Name: C6orf25, G6b, G6b-B, NG31
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073414: 62%, ENSRNOG00000026936: 58%
Entrez Gene ID: 80739
Uniprot ID: O95866
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | APLVKTEPQRPVKEEEPKIPGDLDQEPSLLYADLDHLALSRPRRLSTADPADA |
| Gene Sequence | APLVKTEPQRPVKEEEPKIPGDLDQEPSLLYADLDHLALSRPRRLSTADPADA |
| Gene ID - Mouse | ENSMUSG00000073414 |
| Gene ID - Rat | ENSRNOG00000026936 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MPIG6B pAb (ATL-HPA054404) | |
| Datasheet | Anti MPIG6B pAb (ATL-HPA054404) Datasheet (External Link) |
| Vendor Page | Anti MPIG6B pAb (ATL-HPA054404) at Atlas Antibodies |
| Documents & Links for Anti MPIG6B pAb (ATL-HPA054404) | |
| Datasheet | Anti MPIG6B pAb (ATL-HPA054404) Datasheet (External Link) |
| Vendor Page | Anti MPIG6B pAb (ATL-HPA054404) |