Anti MPHOSPH8 pAb (ATL-HPA040035 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA040035-25

Protein Description: M-phase phosphoprotein 8
Gene Name: MPHOSPH8
Alternative Gene Name: HSMPP8, mpp8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079184: 79%, ENSRNOG00000061152: 77%
Entrez Gene ID: 54737
Uniprot ID: Q99549
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KRHDSDKEEKGRKEPKGLKTLKEIRNAFDLFKLTPEEKNDVSENNRKREEIPLDFKTIDDHKTKENKQSLKERRNTRDETDTWAYIAAEGDQEVLDSVCQADENSDGR
• Gene Sequence: KRHDSDKEEKGRKEPKGLKTLKEIRNAFDLFKLTPEEKNDVSENNRKREEIPLDFKTIDDHKTKENKQSLKERRNTRDETDTWAYIAAEGDQEVLDSVCQADENSDGR
• Gene ID - Mouse: ENSMUSG00000079184
• Gene ID - Rat: ENSRNOG00000061152
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MPHOSPH8 pAb (ATL-HPA040035 w/enhanced validation) – 2 Found

Martin, Michaël M; Matkovic, Roy; Larrous, Pauline; Morel, Marina; Lasserre, Angélique; Vauthier, Virginie; Margottin-Goguet, Florence. Binding to DCAF1 distinguishes TASOR and SAMHD1 degradation by HIV-2 Vpx. Plos Pathogens. 2021;17(10):e1009609. 

Vauthier, Virginie; Lasserre, Angélique; Morel, Marina; Versapuech, Margaux; Berlioz-Torrent, Clarisse; Zamborlini, Alessia; Margottin-Goguet, Florence; Matkovic, Roy. HUSH-mediated HIV silencing is independent of TASOR phosphorylation on threonine 819. Retrovirology. 2022;19(1):23.