Anti MPDZ pAb (ATL-HPA020255)

Atlas Antibodies

Catalog No.: ATL-HPA020255-25

Protein Description: multiple PDZ domain protein
Gene Name: MPDZ
Alternative Gene Name: MUPP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028402: 80%, ENSRNOG00000007894: 82%
Entrez Gene ID: 8777
Uniprot ID: O75970
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VVNILKELPIEVTMVCCRRTVPPTTQSELDSLDLCDIELTEKPHVDLGEFIGSSETEDPVLAMTDAGQSTEEVQAPLAMWEAGIQHIELEKGSKGLGFS
• Gene Sequence: VVNILKELPIEVTMVCCRRTVPPTTQSELDSLDLCDIELTEKPHVDLGEFIGSSETEDPVLAMTDAGQSTEEVQAPLAMWEAGIQHIELEKGSKGLGFS
• Gene ID - Mouse: ENSMUSG00000028402
• Gene ID - Rat: ENSRNOG00000007894
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MPDZ pAb (ATL-HPA020255) – 2 Found

Tetzlaff, Fabian; Adam, M Gordian; Feldner, Anja; Moll, Iris; Menuchin, Amitai; Rodriguez-Vita, Juan; Sprinzak, David; Fischer, Andreas. MPDZ promotes DLL4-induced Notch signaling during angiogenesis. Elife. 2018;7( 29620522) 

Palladino, Steven P; Helton, E Scott; Jain, Preti; Dong, Chaoling; Crowley, Michael R; Crossman, David K; Ubogu, Eroboghene E. The Human Blood-Nerve Barrier Transcriptome. Scientific Reports. 2017;7(1):17477.