Anti MPDU1 pAb (ATL-HPA014845)

Atlas Antibodies

Catalog No.:
ATL-HPA014845-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: mannose-P-dolichol utilization defect 1
Gene Name: MPDU1
Alternative Gene Name: CDGIf, Lec35, PQLC5, SL15
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018761: 93%, ENSRNOG00000012162: 83%
Entrez Gene ID: 9526
Uniprot ID: O75352
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen AEADGPLKRLLVPILLPEKCYDQLFVQWDLLHVPCLKILLSK
Gene Sequence AEADGPLKRLLVPILLPEKCYDQLFVQWDLLHVPCLKILLSK
Gene ID - Mouse ENSMUSG00000018761
Gene ID - Rat ENSRNOG00000012162
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MPDU1 pAb (ATL-HPA014845)
Datasheet Anti MPDU1 pAb (ATL-HPA014845) Datasheet (External Link)
Vendor Page Anti MPDU1 pAb (ATL-HPA014845) at Atlas Antibodies

Documents & Links for Anti MPDU1 pAb (ATL-HPA014845)
Datasheet Anti MPDU1 pAb (ATL-HPA014845) Datasheet (External Link)
Vendor Page Anti MPDU1 pAb (ATL-HPA014845)