Anti MPDU1 pAb (ATL-HPA014845)

Atlas Antibodies

Catalog No.: ATL-HPA014845-25

Protein Description: mannose-P-dolichol utilization defect 1
Gene Name: MPDU1
Alternative Gene Name: CDGIf, Lec35, PQLC5, SL15
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018761: 93%, ENSRNOG00000012162: 83%
Entrez Gene ID: 9526
Uniprot ID: O75352
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AEADGPLKRLLVPILLPEKCYDQLFVQWDLLHVPCLKILLSK
• Gene Sequence: AEADGPLKRLLVPILLPEKCYDQLFVQWDLLHVPCLKILLSK
• Gene ID - Mouse: ENSMUSG00000018761
• Gene ID - Rat: ENSRNOG00000012162
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.