Anti MPC2 pAb (ATL-HPA056091)

Atlas Antibodies

Catalog No.:
ATL-HPA056091-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: mitochondrial pyruvate carrier 2
Gene Name: MPC2
Alternative Gene Name: BRP44, DKFZP564B167
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026568: 96%, ENSRNOG00000003150: 96%
Entrez Gene ID: 25874
Uniprot ID: O95563
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EKLRPLYNHPAGPRTVFFWAPIMKWGLVCAGLADMARPAEKLSTAQSAV
Gene Sequence EKLRPLYNHPAGPRTVFFWAPIMKWGLVCAGLADMARPAEKLSTAQSAV
Gene ID - Mouse ENSMUSG00000026568
Gene ID - Rat ENSRNOG00000003150
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MPC2 pAb (ATL-HPA056091)
Datasheet Anti MPC2 pAb (ATL-HPA056091) Datasheet (External Link)
Vendor Page Anti MPC2 pAb (ATL-HPA056091) at Atlas Antibodies

Documents & Links for Anti MPC2 pAb (ATL-HPA056091)
Datasheet Anti MPC2 pAb (ATL-HPA056091) Datasheet (External Link)
Vendor Page Anti MPC2 pAb (ATL-HPA056091)
Citations for Anti MPC2 pAb (ATL-HPA056091) – 1 Found
Zhu, Huanhuan; Wan, Huiting; Wu, Lin; Li, Qing; Liu, Simeng; Duan, Suyan; Huang, Zhimin; Zhang, Chengning; Zhang, Bo; Xing, Changying; Yuan, Yanggang. Mitochondrial pyruvate carrier: a potential target for diabetic nephropathy. Bmc Nephrology. 2020;21(1):274.  PubMed