Anti MPC2 pAb (ATL-HPA056091)
Atlas Antibodies
- Catalog No.:
- ATL-HPA056091-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: MPC2
Alternative Gene Name: BRP44, DKFZP564B167
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026568: 96%, ENSRNOG00000003150: 96%
Entrez Gene ID: 25874
Uniprot ID: O95563
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EKLRPLYNHPAGPRTVFFWAPIMKWGLVCAGLADMARPAEKLSTAQSAV |
Gene Sequence | EKLRPLYNHPAGPRTVFFWAPIMKWGLVCAGLADMARPAEKLSTAQSAV |
Gene ID - Mouse | ENSMUSG00000026568 |
Gene ID - Rat | ENSRNOG00000003150 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti MPC2 pAb (ATL-HPA056091) | |
Datasheet | Anti MPC2 pAb (ATL-HPA056091) Datasheet (External Link) |
Vendor Page | Anti MPC2 pAb (ATL-HPA056091) at Atlas Antibodies |
Documents & Links for Anti MPC2 pAb (ATL-HPA056091) | |
Datasheet | Anti MPC2 pAb (ATL-HPA056091) Datasheet (External Link) |
Vendor Page | Anti MPC2 pAb (ATL-HPA056091) |
Citations for Anti MPC2 pAb (ATL-HPA056091) – 1 Found |
Zhu, Huanhuan; Wan, Huiting; Wu, Lin; Li, Qing; Liu, Simeng; Duan, Suyan; Huang, Zhimin; Zhang, Chengning; Zhang, Bo; Xing, Changying; Yuan, Yanggang. Mitochondrial pyruvate carrier: a potential target for diabetic nephropathy. Bmc Nephrology. 2020;21(1):274. PubMed |