Anti MOSPD3 pAb (ATL-HPA048240)
Atlas Antibodies
- Catalog No.:
- ATL-HPA048240-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: MOSPD3
Alternative Gene Name: CDS3, NET30
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037221: 97%, ENSRNOG00000001396: 97%
Entrez Gene ID: 64598
Uniprot ID: O75425
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PLGPVVPVLVFPPDLVFRADQRSGPRQLLTLYNPTGTALRFRVLCTAPAKYTVFDAEGYVKPQ |
| Gene Sequence | PLGPVVPVLVFPPDLVFRADQRSGPRQLLTLYNPTGTALRFRVLCTAPAKYTVFDAEGYVKPQ |
| Gene ID - Mouse | ENSMUSG00000037221 |
| Gene ID - Rat | ENSRNOG00000001396 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MOSPD3 pAb (ATL-HPA048240) | |
| Datasheet | Anti MOSPD3 pAb (ATL-HPA048240) Datasheet (External Link) |
| Vendor Page | Anti MOSPD3 pAb (ATL-HPA048240) at Atlas Antibodies |
| Documents & Links for Anti MOSPD3 pAb (ATL-HPA048240) | |
| Datasheet | Anti MOSPD3 pAb (ATL-HPA048240) Datasheet (External Link) |
| Vendor Page | Anti MOSPD3 pAb (ATL-HPA048240) |