Anti MOSPD3 pAb (ATL-HPA048240)

Atlas Antibodies

Catalog No.:
ATL-HPA048240-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: motile sperm domain containing 3
Gene Name: MOSPD3
Alternative Gene Name: CDS3, NET30
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037221: 97%, ENSRNOG00000001396: 97%
Entrez Gene ID: 64598
Uniprot ID: O75425
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PLGPVVPVLVFPPDLVFRADQRSGPRQLLTLYNPTGTALRFRVLCTAPAKYTVFDAEGYVKPQ
Gene Sequence PLGPVVPVLVFPPDLVFRADQRSGPRQLLTLYNPTGTALRFRVLCTAPAKYTVFDAEGYVKPQ
Gene ID - Mouse ENSMUSG00000037221
Gene ID - Rat ENSRNOG00000001396
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MOSPD3 pAb (ATL-HPA048240)
Datasheet Anti MOSPD3 pAb (ATL-HPA048240) Datasheet (External Link)
Vendor Page Anti MOSPD3 pAb (ATL-HPA048240) at Atlas Antibodies

Documents & Links for Anti MOSPD3 pAb (ATL-HPA048240)
Datasheet Anti MOSPD3 pAb (ATL-HPA048240) Datasheet (External Link)
Vendor Page Anti MOSPD3 pAb (ATL-HPA048240)