Anti MORN2 pAb (ATL-HPA057815)

Atlas Antibodies

Catalog No.:
ATL-HPA057815-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: MORN repeat containing 2
Gene Name: MORN2
Alternative Gene Name: MOPT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045257: 93%, ENSRNOG00000030319: 96%
Entrez Gene ID: 729967
Uniprot ID: Q502X0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MNGFGRLEHFSGAVYEGQFKDNMFHGLGTYTFPNGAKYTGNFNENRVEGEGEYTDIQGLEWSGNFHFTAAPDLKLK
Gene Sequence MNGFGRLEHFSGAVYEGQFKDNMFHGLGTYTFPNGAKYTGNFNENRVEGEGEYTDIQGLEWSGNFHFTAAPDLKLK
Gene ID - Mouse ENSMUSG00000045257
Gene ID - Rat ENSRNOG00000030319
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MORN2 pAb (ATL-HPA057815)
Datasheet Anti MORN2 pAb (ATL-HPA057815) Datasheet (External Link)
Vendor Page Anti MORN2 pAb (ATL-HPA057815) at Atlas Antibodies

Documents & Links for Anti MORN2 pAb (ATL-HPA057815)
Datasheet Anti MORN2 pAb (ATL-HPA057815) Datasheet (External Link)
Vendor Page Anti MORN2 pAb (ATL-HPA057815)
Citations for Anti MORN2 pAb (ATL-HPA057815) – 1 Found
Goel, Manvi; Aponte, Angel M; Wistow, Graeme; Badea, Tudor C. Molecular studies into cell biological role of Copine-4 in Retinal Ganglion Cells. Plos One. 16(11):e0255860.  PubMed