Anti MORN1 pAb (ATL-HPA070703)

Atlas Antibodies

Catalog No.:
ATL-HPA070703-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: MORN repeat containing 1
Gene Name: MORN1
Alternative Gene Name: FLJ13941
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029049: 77%, ENSRNOG00000014642: 72%
Entrez Gene ID: 79906
Uniprot ID: Q5T089
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SGVTYYGLWINGHPAEQATRIVILGPEVMEVAQGSPFSVNVQLLQDHGEIAKSESGRVLQISAGVRYVQLSAYSEVNFFKVDRDNQETLIQTPF
Gene Sequence SGVTYYGLWINGHPAEQATRIVILGPEVMEVAQGSPFSVNVQLLQDHGEIAKSESGRVLQISAGVRYVQLSAYSEVNFFKVDRDNQETLIQTPF
Gene ID - Mouse ENSMUSG00000029049
Gene ID - Rat ENSRNOG00000014642
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MORN1 pAb (ATL-HPA070703)
Datasheet Anti MORN1 pAb (ATL-HPA070703) Datasheet (External Link)
Vendor Page Anti MORN1 pAb (ATL-HPA070703) at Atlas Antibodies

Documents & Links for Anti MORN1 pAb (ATL-HPA070703)
Datasheet Anti MORN1 pAb (ATL-HPA070703) Datasheet (External Link)
Vendor Page Anti MORN1 pAb (ATL-HPA070703)