Anti MORF4L2 pAb (ATL-HPA031872)

Atlas Antibodies

Catalog No.:
ATL-HPA031872-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: mortality factor 4 like 2
Gene Name: MORF4L2
Alternative Gene Name: KIAA0026, MRGX
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031422: 90%, ENSRNOG00000002389: 91%
Entrez Gene ID: 9643
Uniprot ID: Q15014
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QPRGQQSAEEENFKKPTRSNMQRSKMRGASSGKKTAGPQQKNLEPALPGRWGGRSAENPPSGSVRKTRKNKQKTPGNGDGGS
Gene Sequence QPRGQQSAEEENFKKPTRSNMQRSKMRGASSGKKTAGPQQKNLEPALPGRWGGRSAENPPSGSVRKTRKNKQKTPGNGDGGS
Gene ID - Mouse ENSMUSG00000031422
Gene ID - Rat ENSRNOG00000002389
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MORF4L2 pAb (ATL-HPA031872)
Datasheet Anti MORF4L2 pAb (ATL-HPA031872) Datasheet (External Link)
Vendor Page Anti MORF4L2 pAb (ATL-HPA031872) at Atlas Antibodies

Documents & Links for Anti MORF4L2 pAb (ATL-HPA031872)
Datasheet Anti MORF4L2 pAb (ATL-HPA031872) Datasheet (External Link)
Vendor Page Anti MORF4L2 pAb (ATL-HPA031872)