Anti MORF4L1 pAb (ATL-HPA062010)

Atlas Antibodies

Catalog No.:
ATL-HPA062010-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: mortality factor 4 like 1
Gene Name: MORF4L1
Alternative Gene Name: Eaf3, HsT17725, MEAF3, MORFRG15, MRG15
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062270: 100%, ENSRNOG00000058412: 100%
Entrez Gene ID: 10933
Uniprot ID: Q9UBU8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QKANQEQYAEGKMRGAAPGKKTSGLQQKNVEVKTKKNKQK
Gene Sequence QKANQEQYAEGKMRGAAPGKKTSGLQQKNVEVKTKKNKQK
Gene ID - Mouse ENSMUSG00000062270
Gene ID - Rat ENSRNOG00000058412
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MORF4L1 pAb (ATL-HPA062010)
Datasheet Anti MORF4L1 pAb (ATL-HPA062010) Datasheet (External Link)
Vendor Page Anti MORF4L1 pAb (ATL-HPA062010) at Atlas Antibodies

Documents & Links for Anti MORF4L1 pAb (ATL-HPA062010)
Datasheet Anti MORF4L1 pAb (ATL-HPA062010) Datasheet (External Link)
Vendor Page Anti MORF4L1 pAb (ATL-HPA062010)