Anti MORC4 pAb (ATL-HPA000395 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA000395-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: MORC4
Alternative Gene Name: FLJ11565, ZCW4, ZCWCC2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031434: 66%, ENSRNOG00000060846: 67%
Entrez Gene ID: 79710
Uniprot ID: Q8TE76
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PRLVAEESNRGSTTINKEEVNKGPFVAVVGVAKGVRDSGAPIQLIPFNREELAERRKAVESWNPVPYSVASAAIPAAAIGEKARGYEESEGHNTPKLKNQRELEELKRTTEKLERVLAERNLFQQ |
| Gene Sequence | PRLVAEESNRGSTTINKEEVNKGPFVAVVGVAKGVRDSGAPIQLIPFNREELAERRKAVESWNPVPYSVASAAIPAAAIGEKARGYEESEGHNTPKLKNQRELEELKRTTEKLERVLAERNLFQQ |
| Gene ID - Mouse | ENSMUSG00000031434 |
| Gene ID - Rat | ENSRNOG00000060846 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MORC4 pAb (ATL-HPA000395 w/enhanced validation) | |
| Datasheet | Anti MORC4 pAb (ATL-HPA000395 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti MORC4 pAb (ATL-HPA000395 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti MORC4 pAb (ATL-HPA000395 w/enhanced validation) | |
| Datasheet | Anti MORC4 pAb (ATL-HPA000395 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti MORC4 pAb (ATL-HPA000395 w/enhanced validation) |
| Citations for Anti MORC4 pAb (ATL-HPA000395 w/enhanced validation) – 2 Found |
| Luo, Jing; Zeng, Shiyan; Tian, Chao. MORC4 Promotes Chemoresistance of Luminal A/B Breast Cancer via STAT3-Mediated MID2 Upregulation. Oncotargets And Therapy. 13( 32764967):6795-6803. PubMed |
| Strack, Elisabeth; Rolfe, P Alexander; Fink, Annika F; Bankov, Katrin; Schmid, Tobias; Solbach, Christine; Savai, Rajkumar; Sha, Weixiao; Pradel, Leon; Hartmann, Sylvia; Brüne, Bernhard; Weigert, Andreas. Identification of tumor-associated macrophage subsets that are associated with breast cancer prognosis. Clinical And Translational Medicine. 2020;10(8):e239. PubMed |