Anti MORC3 pAb (ATL-HPA018406)

Atlas Antibodies

Catalog No.: ATL-HPA018406-25

Protein Description: MORC family CW-type zinc finger 3
Gene Name: MORC3
Alternative Gene Name: KIAA0136, NXP2, ZCW5, ZCWCC3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039456: 72%, ENSRNOG00000026236: 72%
Entrez Gene ID: 23515
Uniprot ID: Q14149
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QETTDKSADDAGCQLQELRNQLLLVTEEKENYKRQCHMFTDQIKVLQQRILEMNDKYVKKETCHQSTETDAVFLLESINGKSESPDHMVSQYQQALEEI
• Gene Sequence: QETTDKSADDAGCQLQELRNQLLLVTEEKENYKRQCHMFTDQIKVLQQRILEMNDKYVKKETCHQSTETDAVFLLESINGKSESPDHMVSQYQQALEEI
• Gene ID - Mouse: ENSMUSG00000039456
• Gene ID - Rat: ENSRNOG00000026236
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.