Anti MON1A pAb (ATL-HPA058032)

Atlas Antibodies

Catalog No.:
ATL-HPA058032-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: MON1 secretory trafficking family member A
Gene Name: MON1A
Alternative Gene Name: MGC13272, SAND1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032583: 100%, ENSRNOG00000018502: 100%
Entrez Gene ID: 84315
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VALVSFLEADKNAIRSIHADGYKVVFVRRSPLVLVAVARTRQSAQELAQELLYIYYQILSLLTGAQLSHIFQQKQN
Gene Sequence VALVSFLEADKNAIRSIHADGYKVVFVRRSPLVLVAVARTRQSAQELAQELLYIYYQILSLLTGAQLSHIFQQKQN
Gene ID - Mouse ENSMUSG00000032583
Gene ID - Rat ENSRNOG00000018502
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MON1A pAb (ATL-HPA058032)
Datasheet Anti MON1A pAb (ATL-HPA058032) Datasheet (External Link)
Vendor Page Anti MON1A pAb (ATL-HPA058032) at Atlas Antibodies

Documents & Links for Anti MON1A pAb (ATL-HPA058032)
Datasheet Anti MON1A pAb (ATL-HPA058032) Datasheet (External Link)
Vendor Page Anti MON1A pAb (ATL-HPA058032)