Anti MON1A pAb (ATL-HPA058032)

Atlas Antibodies

Catalog No.: ATL-HPA058032-25

Protein Description: MON1 secretory trafficking family member A
Gene Name: MON1A
Alternative Gene Name: MGC13272, SAND1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032583: 100%, ENSRNOG00000018502: 100%
Entrez Gene ID: 84315
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VALVSFLEADKNAIRSIHADGYKVVFVRRSPLVLVAVARTRQSAQELAQELLYIYYQILSLLTGAQLSHIFQQKQN
• Gene Sequence: VALVSFLEADKNAIRSIHADGYKVVFVRRSPLVLVAVARTRQSAQELAQELLYIYYQILSLLTGAQLSHIFQQKQN
• Gene ID - Mouse: ENSMUSG00000032583
• Gene ID - Rat: ENSRNOG00000018502
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.