Anti MOGAT1 pAb (ATL-HPA049944)

Atlas Antibodies

Catalog No.: ATL-HPA049944-25

Protein Description: monoacylglycerol O-acyltransferase 1
Gene Name: MOGAT1
Alternative Gene Name: DGAT2L, DGAT2L1, MGAT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000012187: 89%, ENSRNOG00000014692: 87%
Entrez Gene ID: 116255
Uniprot ID: Q96PD6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PIPVRQTLNPTQEQIEELHQTYMEELRKLFEEHKGKYGIPEHETLV
• Gene Sequence: PIPVRQTLNPTQEQIEELHQTYMEELRKLFEEHKGKYGIPEHETLV
• Gene ID - Mouse: ENSMUSG00000012187
• Gene ID - Rat: ENSRNOG00000014692
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.