Anti MOCS1 pAb (ATL-HPA058177)

Atlas Antibodies

Catalog No.:
ATL-HPA058177-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: molybdenum cofactor synthesis 1
Gene Name: MOCS1
Alternative Gene Name: MOCOD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000064120: 87%, ENSRNOG00000011784: 90%
Entrez Gene ID: 4337
Uniprot ID: Q9NZB8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KANLLTTEEILTLARLFVKEGIDKIRLTGGEPLIRPDVVDIVAQLQRLEGLRTIGVTTNGINLARLLPQLQKAGLSAIN
Gene Sequence KANLLTTEEILTLARLFVKEGIDKIRLTGGEPLIRPDVVDIVAQLQRLEGLRTIGVTTNGINLARLLPQLQKAGLSAIN
Gene ID - Mouse ENSMUSG00000064120
Gene ID - Rat ENSRNOG00000011784
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MOCS1 pAb (ATL-HPA058177)
Datasheet Anti MOCS1 pAb (ATL-HPA058177) Datasheet (External Link)
Vendor Page Anti MOCS1 pAb (ATL-HPA058177) at Atlas Antibodies

Documents & Links for Anti MOCS1 pAb (ATL-HPA058177)
Datasheet Anti MOCS1 pAb (ATL-HPA058177) Datasheet (External Link)
Vendor Page Anti MOCS1 pAb (ATL-HPA058177)