Anti MOBP pAb (ATL-HPA035152)
Atlas Antibodies
- Catalog No.:
- ATL-HPA035152-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: MOBP
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032517: 96%, ENSRNOG00000018700: 96%
Entrez Gene ID: 4336
Uniprot ID: Q13875
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SQKPAKEGPRLSKNQKYSEHFSIHCCPPFTFLNSKKEIVDRKYSICKSGCFYQKKEEDWICCACQKTR |
| Gene Sequence | SQKPAKEGPRLSKNQKYSEHFSIHCCPPFTFLNSKKEIVDRKYSICKSGCFYQKKEEDWICCACQKTR |
| Gene ID - Mouse | ENSMUSG00000032517 |
| Gene ID - Rat | ENSRNOG00000018700 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MOBP pAb (ATL-HPA035152) | |
| Datasheet | Anti MOBP pAb (ATL-HPA035152) Datasheet (External Link) |
| Vendor Page | Anti MOBP pAb (ATL-HPA035152) at Atlas Antibodies |
| Documents & Links for Anti MOBP pAb (ATL-HPA035152) | |
| Datasheet | Anti MOBP pAb (ATL-HPA035152) Datasheet (External Link) |
| Vendor Page | Anti MOBP pAb (ATL-HPA035152) |
| Citations for Anti MOBP pAb (ATL-HPA035152) – 3 Found |
| Scholl, Theresa; Mühlebner, Angelika; Ricken, Gerda; Gruber, Victoria; Fabing, Anna; Samueli, Sharon; Gröppel, Gudrun; Dorfer, Christian; Czech, Thomas; Hainfellner, Johannes A; Prabowo, Avanita S; Reinten, Roy J; Hoogendijk, Lisette; Anink, Jasper J; Aronica, Eleonora; Feucht, Martha. Impaired oligodendroglial turnover is associated with myelin pathology in focal cortical dysplasia and tuberous sclerosis complex. Brain Pathology (Zurich, Switzerland). 2017;27(6):770-780. PubMed |
| Mühlebner, Angelika; van Scheppingen, Jackelien; de Neef, Andrew; Bongaarts, Anika; Zimmer, Till S; Mills, James D; Jansen, Floor E; Spliet, Wim G M; Krsek, Pavel; Zamecnik, Josef; Coras, Roland; Blumcke, Ingmar; Feucht, Martha; Scholl, Theresa; Gruber, Victoria-Elisabeth; Hainfellner, Johannes A; Söylemezoğlu, Figen; Kotulska, Katarzyna; Lagae, Lieven; Jansen, Anna C; Kwiatkowski, David J; Jozwiak, Sergiusz; Curatolo, Paolo; Aronica, Eleonora. Myelin Pathology Beyond White Matter in Tuberous Sclerosis Complex (TSC) Cortical Tubers. Journal Of Neuropathology And Experimental Neurology. 2020;79(10):1054-1064. PubMed |
| Bettencourt, Conceição; Miki, Yasuo; Piras, Ignazio S; de Silva, Rohan; Foti, Sandrine C; Talboom, Joshua S; Revesz, Tamas; Lashley, Tammaryn; Balazs, Robert; Viré, Emmanuelle; Warner, Thomas T; Huentelman, Matt J; Holton, Janice L. MOBP and HIP1 in multiple system atrophy: New α-synuclein partners in glial cytoplasmic inclusions implicated in the disease pathogenesis. Neuropathology And Applied Neurobiology. 2021;47(5):640-652. PubMed |