Anti MOB1A pAb (ATL-HPA071690)

Atlas Antibodies

Catalog No.: ATL-HPA071690-25

Protein Description: MOB kinase activator 1A
Gene Name: MOB1A
Alternative Gene Name: C2orf6, FLJ10788, FLJ11595, Mats1, MOB1, Mob4B, MOBK1B, MOBKL1B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006262: 100%, ENSRNOG00000059474: 100%
Entrez Gene ID: 55233
Uniprot ID: Q9H8S9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNL
• Gene Sequence: RSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNL
• Gene ID - Mouse: ENSMUSG00000006262
• Gene ID - Rat: ENSRNOG00000059474
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.