Anti MOB1A pAb (ATL-HPA071690)

Atlas Antibodies

Catalog No.:
ATL-HPA071690-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: MOB kinase activator 1A
Gene Name: MOB1A
Alternative Gene Name: C2orf6, FLJ10788, FLJ11595, Mats1, MOB1, Mob4B, MOBK1B, MOBKL1B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006262: 100%, ENSRNOG00000059474: 100%
Entrez Gene ID: 55233
Uniprot ID: Q9H8S9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNL
Gene Sequence RSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNL
Gene ID - Mouse ENSMUSG00000006262
Gene ID - Rat ENSRNOG00000059474
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MOB1A pAb (ATL-HPA071690)
Datasheet Anti MOB1A pAb (ATL-HPA071690) Datasheet (External Link)
Vendor Page Anti MOB1A pAb (ATL-HPA071690) at Atlas Antibodies

Documents & Links for Anti MOB1A pAb (ATL-HPA071690)
Datasheet Anti MOB1A pAb (ATL-HPA071690) Datasheet (External Link)
Vendor Page Anti MOB1A pAb (ATL-HPA071690)