Anti MOAP1 pAb (ATL-HPA076948)

Atlas Antibodies

Catalog No.: ATL-HPA076948-25

Protein Description: modulator of apoptosis 1
Gene Name: MOAP1
Alternative Gene Name: MAP-1, PNMA4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000096458: 68%, ENSRNOG00000033970: 68%
Entrez Gene ID: 64112
Uniprot ID: Q96BY2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GEGMTVGELSRALGHENGSLDPEQGMIPEMWAPMLAQALEALQPALQCLKYKKLRVFSGRESPEPGEEEFGRWMF
• Gene Sequence: GEGMTVGELSRALGHENGSLDPEQGMIPEMWAPMLAQALEALQPALQCLKYKKLRVFSGRESPEPGEEEFGRWMF
• Gene ID - Mouse: ENSMUSG00000096458
• Gene ID - Rat: ENSRNOG00000033970
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.