Anti MOAP1 pAb (ATL-HPA076948)

Atlas Antibodies

Catalog No.:
ATL-HPA076948-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: modulator of apoptosis 1
Gene Name: MOAP1
Alternative Gene Name: MAP-1, PNMA4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000096458: 68%, ENSRNOG00000033970: 68%
Entrez Gene ID: 64112
Uniprot ID: Q96BY2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GEGMTVGELSRALGHENGSLDPEQGMIPEMWAPMLAQALEALQPALQCLKYKKLRVFSGRESPEPGEEEFGRWMF
Gene Sequence GEGMTVGELSRALGHENGSLDPEQGMIPEMWAPMLAQALEALQPALQCLKYKKLRVFSGRESPEPGEEEFGRWMF
Gene ID - Mouse ENSMUSG00000096458
Gene ID - Rat ENSRNOG00000033970
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MOAP1 pAb (ATL-HPA076948)
Datasheet Anti MOAP1 pAb (ATL-HPA076948) Datasheet (External Link)
Vendor Page Anti MOAP1 pAb (ATL-HPA076948) at Atlas Antibodies

Documents & Links for Anti MOAP1 pAb (ATL-HPA076948)
Datasheet Anti MOAP1 pAb (ATL-HPA076948) Datasheet (External Link)
Vendor Page Anti MOAP1 pAb (ATL-HPA076948)