Anti MNT pAb (ATL-HPA067578)

Atlas Antibodies

Catalog No.: ATL-HPA067578-25

Protein Description: MAX network transcriptional repressor
Gene Name: MNT
Alternative Gene Name: bHLHd3, MAD6, MXD6, ROX
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000282: 89%, ENSRNOG00000002894: 89%
Entrez Gene ID: 4335
Uniprot ID: Q99583
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SIETLLEAARFLEWQAQQQQRAREEQERLRLEQEREQEQKKANSLARLAHTLPVEEPRMEAPPLPLSPPA
• Gene Sequence: SIETLLEAARFLEWQAQQQQRAREEQERLRLEQEREQEQKKANSLARLAHTLPVEEPRMEAPPLPLSPPA
• Gene ID - Mouse: ENSMUSG00000000282
• Gene ID - Rat: ENSRNOG00000002894
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.