Anti MNT pAb (ATL-HPA067578)

Atlas Antibodies

Catalog No.:
ATL-HPA067578-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: MAX network transcriptional repressor
Gene Name: MNT
Alternative Gene Name: bHLHd3, MAD6, MXD6, ROX
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000282: 89%, ENSRNOG00000002894: 89%
Entrez Gene ID: 4335
Uniprot ID: Q99583
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SIETLLEAARFLEWQAQQQQRAREEQERLRLEQEREQEQKKANSLARLAHTLPVEEPRMEAPPLPLSPPA
Gene Sequence SIETLLEAARFLEWQAQQQQRAREEQERLRLEQEREQEQKKANSLARLAHTLPVEEPRMEAPPLPLSPPA
Gene ID - Mouse ENSMUSG00000000282
Gene ID - Rat ENSRNOG00000002894
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MNT pAb (ATL-HPA067578)
Datasheet Anti MNT pAb (ATL-HPA067578) Datasheet (External Link)
Vendor Page Anti MNT pAb (ATL-HPA067578) at Atlas Antibodies

Documents & Links for Anti MNT pAb (ATL-HPA067578)
Datasheet Anti MNT pAb (ATL-HPA067578) Datasheet (External Link)
Vendor Page Anti MNT pAb (ATL-HPA067578)