Anti MMS19 pAb (ATL-HPA056299)

Atlas Antibodies

Catalog No.:
ATL-HPA056299-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: MMS19 nucleotide excision repair homolog (S. cerevisiae)
Gene Name: MMS19
Alternative Gene Name: hMMS19, MET18, MMS19L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025159: 87%, ENSRNOG00000046769: 84%
Entrez Gene ID: 64210
Uniprot ID: Q96T76
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IVPLFLDGNVSFLPENSFPSRFQPFQDGSSGQRRLIALLMAFVCSLPRNVEIPQLNQLMRELLELSCCHSCPFSSTAAAKCFAGLLNKHPA
Gene Sequence IVPLFLDGNVSFLPENSFPSRFQPFQDGSSGQRRLIALLMAFVCSLPRNVEIPQLNQLMRELLELSCCHSCPFSSTAAAKCFAGLLNKHPA
Gene ID - Mouse ENSMUSG00000025159
Gene ID - Rat ENSRNOG00000046769
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MMS19 pAb (ATL-HPA056299)
Datasheet Anti MMS19 pAb (ATL-HPA056299) Datasheet (External Link)
Vendor Page Anti MMS19 pAb (ATL-HPA056299) at Atlas Antibodies

Documents & Links for Anti MMS19 pAb (ATL-HPA056299)
Datasheet Anti MMS19 pAb (ATL-HPA056299) Datasheet (External Link)
Vendor Page Anti MMS19 pAb (ATL-HPA056299)