Anti MMS19 pAb (ATL-HPA056299)

Atlas Antibodies

Catalog No.: ATL-HPA056299-25

Protein Description: MMS19 nucleotide excision repair homolog (S. cerevisiae)
Gene Name: MMS19
Alternative Gene Name: hMMS19, MET18, MMS19L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025159: 87%, ENSRNOG00000046769: 84%
Entrez Gene ID: 64210
Uniprot ID: Q96T76
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IVPLFLDGNVSFLPENSFPSRFQPFQDGSSGQRRLIALLMAFVCSLPRNVEIPQLNQLMRELLELSCCHSCPFSSTAAAKCFAGLLNKHPA
• Gene Sequence: IVPLFLDGNVSFLPENSFPSRFQPFQDGSSGQRRLIALLMAFVCSLPRNVEIPQLNQLMRELLELSCCHSCPFSSTAAAKCFAGLLNKHPA
• Gene ID - Mouse: ENSMUSG00000025159
• Gene ID - Rat: ENSRNOG00000046769
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.