Anti MMS19 pAb (ATL-HPA051936)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051936-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: MMS19
Alternative Gene Name: hMMS19, MET18, MMS19L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025159: 90%, ENSRNOG00000046769: 88%
Entrez Gene ID: 64210
Uniprot ID: Q96T76
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LVFMALTDPSTQLQLVGIRTLTVLGAQPDLLSYEDLELAVGHLYRLSFLKEDSQSCRVAALEASGTLAALYPVAFSSHLVPKLA |
| Gene Sequence | LVFMALTDPSTQLQLVGIRTLTVLGAQPDLLSYEDLELAVGHLYRLSFLKEDSQSCRVAALEASGTLAALYPVAFSSHLVPKLA |
| Gene ID - Mouse | ENSMUSG00000025159 |
| Gene ID - Rat | ENSRNOG00000046769 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MMS19 pAb (ATL-HPA051936) | |
| Datasheet | Anti MMS19 pAb (ATL-HPA051936) Datasheet (External Link) |
| Vendor Page | Anti MMS19 pAb (ATL-HPA051936) at Atlas Antibodies |
| Documents & Links for Anti MMS19 pAb (ATL-HPA051936) | |
| Datasheet | Anti MMS19 pAb (ATL-HPA051936) Datasheet (External Link) |
| Vendor Page | Anti MMS19 pAb (ATL-HPA051936) |