Anti MMRN2 pAb (ATL-HPA020741)

Atlas Antibodies

Catalog No.: ATL-HPA020741-25

Protein Description: multimerin 2
Gene Name: MMRN2
Alternative Gene Name: EMILIN3, EndoGlyx-1, FLJ13465
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041445: 73%, ENSRNOG00000051977: 73%
Entrez Gene ID: 79812
Uniprot ID: Q9H8L6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HAQHFTLHRSISELQADVDTKLKRLHKAQEAPGTNGSLVLATPGAGARPEPDSLQARLGQLQRNLSELHMTTARREEELQYTLEDMRATLTRHVDEIKELYSESDETFDQISKVERQVEELQVNHTALRELRVILMEK
• Gene Sequence: HAQHFTLHRSISELQADVDTKLKRLHKAQEAPGTNGSLVLATPGAGARPEPDSLQARLGQLQRNLSELHMTTARREEELQYTLEDMRATLTRHVDEIKELYSESDETFDQISKVERQVEELQVNHTALRELRVILMEK
• Gene ID - Mouse: ENSMUSG00000041445
• Gene ID - Rat: ENSRNOG00000051977
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MMRN2 pAb (ATL-HPA020741) – 1 Found

Lugano, Roberta; Vemuri, Kalyani; Yu, Di; Bergqvist, Michael; Smits, Anja; Essand, Magnus; Johansson, Staffan; Dejana, Elisabetta; Dimberg, Anna. CD93 promotes β1 integrin activation and fibronectin fibrillogenesis during tumor angiogenesis. The Journal Of Clinical Investigation. 2018;128(8):3280-3297.