Anti MMP9 pAb (ATL-HPA001238 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA001238-25
- Shipping:
- Calculated at Checkout
$351.00
Gene Name: MMP9
Alternative Gene Name: CLG4B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017737: 78%, ENSRNOG00000017539: 80%
Entrez Gene ID: 4318
Uniprot ID: P14780
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADI |
| Gene Sequence | PRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADI |
| Gene ID - Mouse | ENSMUSG00000017737 |
| Gene ID - Rat | ENSRNOG00000017539 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MMP9 pAb (ATL-HPA001238 w/enhanced validation) | |
| Datasheet | Anti MMP9 pAb (ATL-HPA001238 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti MMP9 pAb (ATL-HPA001238 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti MMP9 pAb (ATL-HPA001238 w/enhanced validation) | |
| Datasheet | Anti MMP9 pAb (ATL-HPA001238 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti MMP9 pAb (ATL-HPA001238 w/enhanced validation) |
| Citations for Anti MMP9 pAb (ATL-HPA001238 w/enhanced validation) – 10 Found |
| Dong, Peixin; Xiong, Ying; Watari, Hidemichi; Hanley, Sharon Jb; Konno, Yosuke; Ihira, Kei; Suzuki, Fumihiko; Yamada, Takahiro; Kudo, Masataka; Yue, Junming; Sakuragi, Noriaki. Suppression of iASPP-dependent aggressiveness in cervical cancer through reversal of methylation silencing of microRNA-124. Scientific Reports. 2016;6( 27765948):35480. PubMed |
| Yang, Ran; Zhang, Yunpei; Huang, Dandan; Luo, Xiao; Zhang, Liangren; Zhu, Xiaojun; Zhang, Xiaolin; Liu, Zhenming; Han, Jing-Yan; Xiong, Jing-Wei. Miconazole protects blood vessels from MMP9-dependent rupture and hemorrhage. Disease Models & Mechanisms. 2017;10(3):337-348. PubMed |
| Zeng, Lin-Ru; Zhu, Fang-Bing; Wang, Jian-Yue; Hou, Qiao; Yue, Zhen-Shuang; Yan, Shi-Gui; Quan, Ren-Fu; Zhang, Ying-Liang. Local influence of high molecular polyethylene particles on heterotopic ossification. Experimental And Therapeutic Medicine. 2017;13(6):2934-2938. PubMed |
| Wang, Guodong; Liu, Jian; Cai, Yi; Chen, Jie; Xie, Wenbing; Kong, Xiangqian; Huang, Wenjie; Guo, Hao; Zhao, Xiaodi; Lu, Yuanyuan; Niu, Lu; Li, Xiaowei; Zhang, Haijia; Lei, Chao; Lei, Zhijie; Yin, Jipeng; Hu, Hao; Yu, Fan; Nie, Yongzhan; Xia, Limin; Wu, Kaichun. Loss of Barx1 promotes hepatocellular carcinoma metastasis through up-regulating MGAT5 and MMP9 expression and indicates poor prognosis. Oncotarget. 2017;8(42):71867-71880. PubMed |
| Gouravan, Sarina; Meza-Zepeda, Leonardo A; Myklebost, Ola; Stratford, Eva W; Munthe, Else. Preclinical Evaluation of Vemurafenib as Therapy for BRAF(V600E) Mutated Sarcomas. International Journal Of Molecular Sciences. 2018;19(4) PubMed |
| Boonsongserm, Papatson; Angsuwatcharakon, Phonthep; Puttipanyalears, Charoenchai; Aporntewan, Chatchawit; Kongruttanachok, Narisorn; Aksornkitti, Vitavat; Kitkumthorn, Nakarin; Mutirangura, Apiwat. Tumor-induced DNA methylation in the white blood cells of patients with colorectal cancer. Oncology Letters. 2019;18(3):3039-3048. PubMed |
| Song, Chenlin; Zhu, Songcheng; Wu, Chuanyue; Kang, Jiuhong. Histone deacetylase (HDAC) 10 suppresses cervical cancer metastasis through inhibition of matrix metalloproteinase (MMP) 2 and 9 expression. The Journal Of Biological Chemistry. 2013;288(39):28021-33. PubMed |
| Bass, Julie A; Friesen, Craig A; Deacy, Amanda D; Neilan, Nancy A; Bracken, Julia M; Shakhnovich, Valentina; Singh, Vivekanand. Investigation of potential early Histologic markers of pediatric inflammatory bowel disease. Bmc Gastroenterology. 2015;15( 26463759):129. PubMed |
| Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476. PubMed |
| van IJzendoorn, David G P; Matusiak, Magdalena; Charville, Gregory W; Spierenburg, Geert; Varma, Sushama; Colburg, Deana R C; van de Sande, Michiel A J; van Langevelde, Kirsten; Mohler, David G; Ganjoo, Kristen N; Bui, Nam Q; Avedian, Raffi S; Bovée, Judith V M G; Steffner, Robert; West, Robert B; van de Rijn, Matt. Interactions in CSF1-Driven Tenosynovial Giant Cell Tumors. Clinical Cancer Research : An Official Journal Of The American Association For Cancer Research. 2022;28(22):4934-4946. PubMed |