Anti MMP8 pAb (ATL-HPA021221)

Atlas Antibodies

Catalog No.:
ATL-HPA021221-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: matrix metallopeptidase 8 (neutrophil collagenase)
Gene Name: MMP8
Alternative Gene Name: CLG1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005800: 78%, ENSRNOG00000009907: 69%
Entrez Gene ID: 4317
Uniprot ID: P22894
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KWERTNLTYRIRNYTPQLSEAEVERAIKDAFELWSVASPLIFTRISQGEADINIAFYQRDHGDNSPFDGPNG
Gene Sequence KWERTNLTYRIRNYTPQLSEAEVERAIKDAFELWSVASPLIFTRISQGEADINIAFYQRDHGDNSPFDGPNG
Gene ID - Mouse ENSMUSG00000005800
Gene ID - Rat ENSRNOG00000009907
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MMP8 pAb (ATL-HPA021221)
Datasheet Anti MMP8 pAb (ATL-HPA021221) Datasheet (External Link)
Vendor Page Anti MMP8 pAb (ATL-HPA021221) at Atlas Antibodies

Documents & Links for Anti MMP8 pAb (ATL-HPA021221)
Datasheet Anti MMP8 pAb (ATL-HPA021221) Datasheet (External Link)
Vendor Page Anti MMP8 pAb (ATL-HPA021221)
Citations for Anti MMP8 pAb (ATL-HPA021221) – 1 Found
Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476.  PubMed