Anti MMP3 pAb (ATL-HPA007875 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA007875-25

Protein Description: matrix metallopeptidase 3 (stromelysin 1, progelatinase)
Gene Name: MMP3
Alternative Gene Name: STMY, STMY1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043613: 70%, ENSRNOG00000032626: 70%
Entrez Gene ID: 4314
Uniprot ID: P08254
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MYPLYHSLTDLTRFRLSQDDINGIQSLYGPPPDSPETPLVPTEPVPPEPGTPANCDPALSFDAVSTLRGEILIFKDRHFWRKSLRKLEPELHLISSFWPSLPSGVDAAYEVTSKDLVFIFKGNQFWAI
• Gene Sequence: MYPLYHSLTDLTRFRLSQDDINGIQSLYGPPPDSPETPLVPTEPVPPEPGTPANCDPALSFDAVSTLRGEILIFKDRHFWRKSLRKLEPELHLISSFWPSLPSGVDAAYEVTSKDLVFIFKGNQFWAI
• Gene ID - Mouse: ENSMUSG00000043613
• Gene ID - Rat: ENSRNOG00000032626
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MMP3 pAb (ATL-HPA007875 w/enhanced validation) – 4 Found

Ågren, Magnus S; Schnabel, Reinhild; Christensen, Lise H; Mirastschijski, Ursula. Tumor necrosis factor-α-accelerated degradation of type I collagen in human skin is associated with elevated matrix metalloproteinase (MMP)-1 and MMP-3 ex vivo. European Journal Of Cell Biology. 2015;94(1):12-21. 

Huth, Sebastian; Huth, Laura; Marquardt, Yvonne; Cheremkhina, Maria; Heise, Ruth; Baron, Jens Malte. MMP-3 plays a major role in calcium pantothenate-promoted wound healing after fractional ablative laser treatment. Lasers In Medical Science. 2022;37(2):887-894. 

Kato, Bernet S; Nicholson, George; Neiman, Maja; Rantalainen, Mattias; Holmes, Chris C; Barrett, Amy; Uhlén, Mathias; Nilsson, Peter; Spector, Tim D; Schwenk, Jochen M. Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model. Proteome Science. 2011;9( 22093360):73. 

Johnson, Gregory R; Li, Jieyue; Shariff, Aabid; Rohde, Gustavo K; Murphy, Robert F. Automated Learning of Subcellular Variation among Punctate Protein Patterns and a Generative Model of Their Relation to Microtubules. Plos Computational Biology. 2015;11(12):e1004614.