Anti MMP27 pAb (ATL-HPA069097)

Atlas Antibodies

Catalog No.:
ATL-HPA069097-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: matrix metallopeptidase 27
Gene Name: MMP27
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070323: 86%, ENSRNOG00000040208: 83%
Entrez Gene ID: 64066
Uniprot ID: Q9H306
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FWPSLPADLQAAYENPRDKILVFKDENFWMIRGYAVLPDYPKSIHTLGFPGRVKKIDAAVCDKTTR
Gene Sequence FWPSLPADLQAAYENPRDKILVFKDENFWMIRGYAVLPDYPKSIHTLGFPGRVKKIDAAVCDKTTR
Gene ID - Mouse ENSMUSG00000070323
Gene ID - Rat ENSRNOG00000040208
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MMP27 pAb (ATL-HPA069097)
Datasheet Anti MMP27 pAb (ATL-HPA069097) Datasheet (External Link)
Vendor Page Anti MMP27 pAb (ATL-HPA069097) at Atlas Antibodies

Documents & Links for Anti MMP27 pAb (ATL-HPA069097)
Datasheet Anti MMP27 pAb (ATL-HPA069097) Datasheet (External Link)
Vendor Page Anti MMP27 pAb (ATL-HPA069097)