Anti MMP27 pAb (ATL-HPA069097)
Atlas Antibodies
- Catalog No.:
- ATL-HPA069097-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: MMP27
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070323: 86%, ENSRNOG00000040208: 83%
Entrez Gene ID: 64066
Uniprot ID: Q9H306
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FWPSLPADLQAAYENPRDKILVFKDENFWMIRGYAVLPDYPKSIHTLGFPGRVKKIDAAVCDKTTR |
Gene Sequence | FWPSLPADLQAAYENPRDKILVFKDENFWMIRGYAVLPDYPKSIHTLGFPGRVKKIDAAVCDKTTR |
Gene ID - Mouse | ENSMUSG00000070323 |
Gene ID - Rat | ENSRNOG00000040208 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti MMP27 pAb (ATL-HPA069097) | |
Datasheet | Anti MMP27 pAb (ATL-HPA069097) Datasheet (External Link) |
Vendor Page | Anti MMP27 pAb (ATL-HPA069097) at Atlas Antibodies |
Documents & Links for Anti MMP27 pAb (ATL-HPA069097) | |
Datasheet | Anti MMP27 pAb (ATL-HPA069097) Datasheet (External Link) |
Vendor Page | Anti MMP27 pAb (ATL-HPA069097) |