Anti MMP25 pAb (ATL-HPA055640)
Atlas Antibodies
- Catalog No.:
- ATL-HPA055640-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: MMP25
Alternative Gene Name: MMP20, MMPL1, MT6-MMP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023903: 84%, ENSRNOG00000023643: 50%
Entrez Gene ID: 64386
Uniprot ID: Q9NPA2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ETFFFKGPWFWRLQPSGQLVSPRPARLHRFWEGLPAQVRVVQAAYARHRDGRILLFSGPQFWVFQDRQLE |
| Gene Sequence | ETFFFKGPWFWRLQPSGQLVSPRPARLHRFWEGLPAQVRVVQAAYARHRDGRILLFSGPQFWVFQDRQLE |
| Gene ID - Mouse | ENSMUSG00000023903 |
| Gene ID - Rat | ENSRNOG00000023643 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MMP25 pAb (ATL-HPA055640) | |
| Datasheet | Anti MMP25 pAb (ATL-HPA055640) Datasheet (External Link) |
| Vendor Page | Anti MMP25 pAb (ATL-HPA055640) at Atlas Antibodies |
| Documents & Links for Anti MMP25 pAb (ATL-HPA055640) | |
| Datasheet | Anti MMP25 pAb (ATL-HPA055640) Datasheet (External Link) |
| Vendor Page | Anti MMP25 pAb (ATL-HPA055640) |