Anti MMP25 pAb (ATL-HPA055640)
Atlas Antibodies
- Catalog No.:
- ATL-HPA055640-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: MMP25
Alternative Gene Name: MMP20, MMPL1, MT6-MMP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023903: 84%, ENSRNOG00000023643: 50%
Entrez Gene ID: 64386
Uniprot ID: Q9NPA2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ETFFFKGPWFWRLQPSGQLVSPRPARLHRFWEGLPAQVRVVQAAYARHRDGRILLFSGPQFWVFQDRQLE |
Gene Sequence | ETFFFKGPWFWRLQPSGQLVSPRPARLHRFWEGLPAQVRVVQAAYARHRDGRILLFSGPQFWVFQDRQLE |
Gene ID - Mouse | ENSMUSG00000023903 |
Gene ID - Rat | ENSRNOG00000023643 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti MMP25 pAb (ATL-HPA055640) | |
Datasheet | Anti MMP25 pAb (ATL-HPA055640) Datasheet (External Link) |
Vendor Page | Anti MMP25 pAb (ATL-HPA055640) at Atlas Antibodies |
Documents & Links for Anti MMP25 pAb (ATL-HPA055640) | |
Datasheet | Anti MMP25 pAb (ATL-HPA055640) Datasheet (External Link) |
Vendor Page | Anti MMP25 pAb (ATL-HPA055640) |