Anti MMP25 pAb (ATL-HPA055640)

Atlas Antibodies

Catalog No.:
ATL-HPA055640-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: matrix metallopeptidase 25
Gene Name: MMP25
Alternative Gene Name: MMP20, MMPL1, MT6-MMP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023903: 84%, ENSRNOG00000023643: 50%
Entrez Gene ID: 64386
Uniprot ID: Q9NPA2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ETFFFKGPWFWRLQPSGQLVSPRPARLHRFWEGLPAQVRVVQAAYARHRDGRILLFSGPQFWVFQDRQLE
Gene Sequence ETFFFKGPWFWRLQPSGQLVSPRPARLHRFWEGLPAQVRVVQAAYARHRDGRILLFSGPQFWVFQDRQLE
Gene ID - Mouse ENSMUSG00000023903
Gene ID - Rat ENSRNOG00000023643
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MMP25 pAb (ATL-HPA055640)
Datasheet Anti MMP25 pAb (ATL-HPA055640) Datasheet (External Link)
Vendor Page Anti MMP25 pAb (ATL-HPA055640) at Atlas Antibodies

Documents & Links for Anti MMP25 pAb (ATL-HPA055640)
Datasheet Anti MMP25 pAb (ATL-HPA055640) Datasheet (External Link)
Vendor Page Anti MMP25 pAb (ATL-HPA055640)