Anti MMP2 pAb (ATL-HPA001939)

Atlas Antibodies

Catalog No.: ATL-HPA001939-25

Protein Description: matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase)
Gene Name: MMP2
Alternative Gene Name: CLG4, CLG4A, TBE-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031740: 94%, ENSRNOG00000016695: 93%
Entrez Gene ID: 4313
Uniprot ID: P08253
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWS
• Gene Sequence: YGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWS
• Gene ID - Mouse: ENSMUSG00000031740
• Gene ID - Rat: ENSRNOG00000016695
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MMP2 pAb (ATL-HPA001939) – 4 Found

Pingitore, Piero; Dongiovanni, Paola; Motta, Benedetta Maria; Meroni, Marica; Lepore, Saverio Massimo; Mancina, Rosellina Margherita; Pelusi, Serena; Russo, Cristina; Caddeo, Andrea; Rossi, Giorgio; Montalcini, Tiziana; Pujia, Arturo; Wiklund, Olov; Valenti, Luca; Romeo, Stefano. PNPLA3 overexpression results in reduction of proteins predisposing to fibrosis. Human Molecular Genetics. 2016;25(23):5212-5222. 

Shen, Yu-Guang; Feng, Wen; Xu, Yi-Jun; Jiao, Na-Na; Sun, Da-Qiang; Qu, Wen-Dong; Tang, Quan; Xiong, Wei; Tang, Yang; Xia, Yu; Cai, Qing-Yong; Liu, Da-Xing; Zhang, Xun; Xu, Gang; Liang, Gui-You. Effects of RNA silencing of matrix metalloproteinase-2 on the growth of esophageal carcinoma cells in vivo. Oncology Letters. 2017;13(3):1119-1124. 

Bachmann, Julie; Burté, Florence; Pramana, Setia; Conte, Ianina; Brown, Biobele J; Orimadegun, Adebola E; Ajetunmobi, Wasiu A; Afolabi, Nathaniel K; Akinkunmi, Francis; Omokhodion, Samuel; Akinbami, Felix O; Shokunbi, Wuraola A; Kampf, Caroline; Pawitan, Yudi; Uhlén, Mathias; Sodeinde, Olugbemiro; Schwenk, Jochen M; Wahlgren, Mats; Fernandez-Reyes, Delmiro; Nilsson, Peter. Affinity proteomics reveals elevated muscle proteins in plasma of children with cerebral malaria. Plos Pathogens. 2014;10(4):e1004038. 

Georgiev, Georgi P; Landzhov, Boycho; Kotov, Georgi; Slavchev, Svetoslav A; Iliev, Alexandar. Matrix Metalloproteinase-2 and -9 Expression in the Epiligament of the Medial Collateral and Anterior Cruciate Ligament in Human Knees: A Comparative Study. Cureus. 2018;10(11):e3550.