Anti MMP19 pAb (ATL-HPA070804)

Atlas Antibodies

Catalog No.:
ATL-HPA070804-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: matrix metallopeptidase 19
Gene Name: MMP19
Alternative Gene Name: MMP18, RASI-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025355: 80%, ENSRNOG00000006778: 87%
Entrez Gene ID: 4327
Uniprot ID: Q99542
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PVDYLSQYGYLQKPLEGSNNFKPEDITEALRAFQEASELPVSGQLDDATRARMRQPRCGLEDPFNQKTLKYLLLGRWRKKHLTFRILNL
Gene Sequence PVDYLSQYGYLQKPLEGSNNFKPEDITEALRAFQEASELPVSGQLDDATRARMRQPRCGLEDPFNQKTLKYLLLGRWRKKHLTFRILNL
Gene ID - Mouse ENSMUSG00000025355
Gene ID - Rat ENSRNOG00000006778
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MMP19 pAb (ATL-HPA070804)
Datasheet Anti MMP19 pAb (ATL-HPA070804) Datasheet (External Link)
Vendor Page Anti MMP19 pAb (ATL-HPA070804) at Atlas Antibodies

Documents & Links for Anti MMP19 pAb (ATL-HPA070804)
Datasheet Anti MMP19 pAb (ATL-HPA070804) Datasheet (External Link)
Vendor Page Anti MMP19 pAb (ATL-HPA070804)