Anti MMP19 pAb (ATL-HPA070804)

Atlas Antibodies

Catalog No.: ATL-HPA070804-25

Protein Description: matrix metallopeptidase 19
Gene Name: MMP19
Alternative Gene Name: MMP18, RASI-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025355: 80%, ENSRNOG00000006778: 87%
Entrez Gene ID: 4327
Uniprot ID: Q99542
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PVDYLSQYGYLQKPLEGSNNFKPEDITEALRAFQEASELPVSGQLDDATRARMRQPRCGLEDPFNQKTLKYLLLGRWRKKHLTFRILNL
• Gene Sequence: PVDYLSQYGYLQKPLEGSNNFKPEDITEALRAFQEASELPVSGQLDDATRARMRQPRCGLEDPFNQKTLKYLLLGRWRKKHLTFRILNL
• Gene ID - Mouse: ENSMUSG00000025355
• Gene ID - Rat: ENSRNOG00000006778
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.