Anti MMP19 pAb (ATL-HPA070804)
Atlas Antibodies
- Catalog No.:
- ATL-HPA070804-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: MMP19
Alternative Gene Name: MMP18, RASI-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025355: 80%, ENSRNOG00000006778: 87%
Entrez Gene ID: 4327
Uniprot ID: Q99542
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PVDYLSQYGYLQKPLEGSNNFKPEDITEALRAFQEASELPVSGQLDDATRARMRQPRCGLEDPFNQKTLKYLLLGRWRKKHLTFRILNL |
| Gene Sequence | PVDYLSQYGYLQKPLEGSNNFKPEDITEALRAFQEASELPVSGQLDDATRARMRQPRCGLEDPFNQKTLKYLLLGRWRKKHLTFRILNL |
| Gene ID - Mouse | ENSMUSG00000025355 |
| Gene ID - Rat | ENSRNOG00000006778 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MMP19 pAb (ATL-HPA070804) | |
| Datasheet | Anti MMP19 pAb (ATL-HPA070804) Datasheet (External Link) |
| Vendor Page | Anti MMP19 pAb (ATL-HPA070804) at Atlas Antibodies |
| Documents & Links for Anti MMP19 pAb (ATL-HPA070804) | |
| Datasheet | Anti MMP19 pAb (ATL-HPA070804) Datasheet (External Link) |
| Vendor Page | Anti MMP19 pAb (ATL-HPA070804) |