Anti MMP15 pAb (ATL-HPA040390)

Atlas Antibodies

Catalog No.:
ATL-HPA040390-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: matrix metallopeptidase 15 (membrane-inserted)
Gene Name: MMP15
Alternative Gene Name: MT2-MMP, MTMMP2, SMCP-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031790: 71%, ENSRNOG00000012622: 73%
Entrez Gene ID: 4324
Uniprot ID: P51511
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RDFMGCQEHVEPGPRWPDVARPPFNPHGGAEPGADSAEGDVGDGDGDFGAGVNKDGGSRVVVQMEEVARTVNVVMV
Gene Sequence RDFMGCQEHVEPGPRWPDVARPPFNPHGGAEPGADSAEGDVGDGDGDFGAGVNKDGGSRVVVQMEEVARTVNVVMV
Gene ID - Mouse ENSMUSG00000031790
Gene ID - Rat ENSRNOG00000012622
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MMP15 pAb (ATL-HPA040390)
Datasheet Anti MMP15 pAb (ATL-HPA040390) Datasheet (External Link)
Vendor Page Anti MMP15 pAb (ATL-HPA040390) at Atlas Antibodies

Documents & Links for Anti MMP15 pAb (ATL-HPA040390)
Datasheet Anti MMP15 pAb (ATL-HPA040390) Datasheet (External Link)
Vendor Page Anti MMP15 pAb (ATL-HPA040390)