Anti MMP15 pAb (ATL-HPA040390)
Atlas Antibodies
- Catalog No.:
- ATL-HPA040390-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: MMP15
Alternative Gene Name: MT2-MMP, MTMMP2, SMCP-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031790: 71%, ENSRNOG00000012622: 73%
Entrez Gene ID: 4324
Uniprot ID: P51511
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RDFMGCQEHVEPGPRWPDVARPPFNPHGGAEPGADSAEGDVGDGDGDFGAGVNKDGGSRVVVQMEEVARTVNVVMV |
| Gene Sequence | RDFMGCQEHVEPGPRWPDVARPPFNPHGGAEPGADSAEGDVGDGDGDFGAGVNKDGGSRVVVQMEEVARTVNVVMV |
| Gene ID - Mouse | ENSMUSG00000031790 |
| Gene ID - Rat | ENSRNOG00000012622 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MMP15 pAb (ATL-HPA040390) | |
| Datasheet | Anti MMP15 pAb (ATL-HPA040390) Datasheet (External Link) |
| Vendor Page | Anti MMP15 pAb (ATL-HPA040390) at Atlas Antibodies |
| Documents & Links for Anti MMP15 pAb (ATL-HPA040390) | |
| Datasheet | Anti MMP15 pAb (ATL-HPA040390) Datasheet (External Link) |
| Vendor Page | Anti MMP15 pAb (ATL-HPA040390) |