Anti MLLT1 pAb (ATL-HPA031166)

Atlas Antibodies

Catalog No.: ATL-HPA031166-25

Protein Description: myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 1
Gene Name: MLLT1
Alternative Gene Name: ENL, LTG19, YEATS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024212: 84%, ENSRNOG00000048736: 84%
Entrez Gene ID: 4298
Uniprot ID: Q03111
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MVMPEGADTVSRPSPDYPMLPTIPLSAFSDPKKTKPSHGSKDANKESSKTSKPHKVTKEHRERPRKDSESKSSSKELEREQAKSSKDTSRKLGEGRLPKEEKAPPPKAAFKEPKMALKE
• Gene Sequence: MVMPEGADTVSRPSPDYPMLPTIPLSAFSDPKKTKPSHGSKDANKESSKTSKPHKVTKEHRERPRKDSESKSSSKELEREQAKSSKDTSRKLGEGRLPKEEKAPPPKAAFKEPKMALKE
• Gene ID - Mouse: ENSMUSG00000024212
• Gene ID - Rat: ENSRNOG00000048736
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MLLT1 pAb (ATL-HPA031166) – 1 Found

Perlman, Elizabeth J; Gadd, Samantha; Arold, Stefan T; Radhakrishnan, Anand; Gerhard, Daniela S; Jennings, Lawrence; Huff, Vicki; Guidry Auvil, Jaime M; Davidsen, Tanja M; Dome, Jeffrey S; Meerzaman, Daoud; Hsu, Chih Hao; Nguyen, Cu; Anderson, James; Ma, Yussanne; Mungall, Andrew J; Moore, Richard A; Marra, Marco A; Mullighan, Charles G; Ma, Jing; Wheeler, David A; Hampton, Oliver A; Gastier-Foster, Julie M; Ross, Nicole; Smith, Malcolm A. MLLT1 YEATS domain mutations in clinically distinctive Favourable Histology Wilms tumours. Nature Communications. 2015;6( 26635203):10013.