Anti MLIP pAb (ATL-HPA029252)

Atlas Antibodies

Catalog No.: ATL-HPA029252-25

Protein Description: muscular LMNA interacting protein
Gene Name: MLIP
Alternative Gene Name: C6orf142, CIP, MGC18257
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032355: 70%, ENSRNOG00000005934: 68%
Entrez Gene ID: 90523
Uniprot ID: Q5VWP3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SKDNTLEPPVETPTTLPRAAGRETKYANLSSPTSTVSESQLTKPGVIRPVPVKSRI
• Gene Sequence: SKDNTLEPPVETPTTLPRAAGRETKYANLSSPTSTVSESQLTKPGVIRPVPVKSRI
• Gene ID - Mouse: ENSMUSG00000032355
• Gene ID - Rat: ENSRNOG00000005934
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.