Anti MLH3 pAb (ATL-HPA060570)

Atlas Antibodies

Catalog No.:
ATL-HPA060570-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: mutL homolog 3
Gene Name: MLH3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021245: 91%, ENSRNOG00000006699: 94%
Entrez Gene ID: 27030
Uniprot ID: Q9UHC1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TTGGIQGTLPLTVQKVLASQACHGAIKFNDGLSLQESCRLIEALSSCQLPFQCAHGRPSMLPLADIDHLEQEKQIKPNLTKLRKMA
Gene Sequence TTGGIQGTLPLTVQKVLASQACHGAIKFNDGLSLQESCRLIEALSSCQLPFQCAHGRPSMLPLADIDHLEQEKQIKPNLTKLRKMA
Gene ID - Mouse ENSMUSG00000021245
Gene ID - Rat ENSRNOG00000006699
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MLH3 pAb (ATL-HPA060570)
Datasheet Anti MLH3 pAb (ATL-HPA060570) Datasheet (External Link)
Vendor Page Anti MLH3 pAb (ATL-HPA060570) at Atlas Antibodies

Documents & Links for Anti MLH3 pAb (ATL-HPA060570)
Datasheet Anti MLH3 pAb (ATL-HPA060570) Datasheet (External Link)
Vendor Page Anti MLH3 pAb (ATL-HPA060570)